PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00286g04004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 209aa    MW: 24032.1 Da    PI: 5.9719
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00286g04004.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF56.34.2e-181858141
                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                              k+i+n+  r+vtfskR  g++KKA+EL++L +ae+a+i+ s
  Peinf101Scf00286g04004.1 18 KPIDNQASRHVTFSKRHLGLFKKASELCILSGAEIAIILPS 58
                              78************************************877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.8E-201070IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.3011058IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.89E-2211101IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-101232IPR002100Transcription factor, MADS-box
PfamPF003191.2E-162067IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-103247IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MNGNTKKKTQ GRRRIAIKPI DNQASRHVTF SKRHLGLFKK ASELCILSGA EIAIILPSLK  60
RHRLFAFGHP SVDAVIDRYI NGKSSSTTAD QLNNMQQNNQ YYSDICRELE EEKKKKKEVI  120
DEPKIVNDDN DGGFWWDEPT DDFGIDELEE FLTALEELKK NVTMRADDLS MTNARFGAED  180
QYLNKAMNYR ASIGPFDFDH HLLMMENSE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004231377.14e-94PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLK4B2N74e-94K4B2N7_SOLLC; Uncharacterized protein
STRINGSolyc01g106700.2.11e-93(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21342252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-24AGAMOUS-like 62